Welcome to the RAS Solution › Forums › HEC-RAS Help › Warning: Count for bucket 0 exceeds maximum 32 bit value
- This topic has 2 replies, 224 voices, and was last updated 6 years, 11 months ago by GoSparky.
-
AuthorPosts
-
November 9, 2018 at 2:43 am #7115GoSparkyParticipant
I’m looking for help figuring out what this message means and if it’s affecting my model results.
This model is a dam break with all 2D flow area. My suspicion is that something about the grid is too big, because I don’t get it when I run a smaller truncated area. But the model runs to conclusion and has an acceptable amount of error. Is there a guide to HEC-RAS errors somewhere that I can consult? Searching the RAS documentation has not helped me.January 16, 2019 at 5:35 pm #11895AnonymousGuestAny luck resolving this issue?
I am having a similar error except my program is indicating “bucket 255”.
ThanksJanuary 16, 2019 at 10:36 pm #11896GoSparkyParticipantReturn-Path:
Received: from compute1.internal (compute1.nyi.internal [10.202.2.41])
by sloti1d2t14 (Cyrus 3.1.5-761-gc103c9b-fmstable-20190103v1bis) with LMTPA;
Wed, 16 Jan 2019 13:36:42 -0500
X-Cyrus-Session-Id: sloti1d2t14-3404949-1547663802-2-16615122058528103913
X-Sieve: CMU Sieve 3.0
X-Spam-known-sender: no
X-Spam-score: 1.3
X-Spam-hits: HTML_MESSAGE 0.001, ME_ZS_CLEAN -0.01, RCVD_IN_DNSWL_NONE -0.0001,
SPF_HELO_PASS -0.001, SPF_PASS -0.001, URI_HEX 1.313, LANGUAGES en,
BAYES_USED none, SA_VERSION 3.4.2
X-Spam-source: IP=’40.107.77.124′,
Host=’mail-eopbgr770124.outbound.protection.outlook.com’, Country=’US’,
FromHeader=’com’, MailFrom=’com’, XOriginatingCountry=’US’
X-Spam-charsets: plain=’us-ascii’, html=’us-ascii’
X-Resolved-to: [email protected]
X-Delivered-to: [email protected]
X-Mail-from: [email protected]
Received: from mx1 ([10.202.2.200])
by compute1.internal (LMTPProxy); Wed, 16 Jan 2019 13:36:42 -0500
Received: from mx1.messagingengine.com (localhost [127.0.0.1])
by mailmx.nyi.internal (Postfix) with ESMTP id 0C82013085
for; Wed, 16 Jan 2019 13:36:41 -0500 (EST)
Received: from mx1.messagingengine.com (localhost [127.0.0.1])
by mx1.messagingengine.com (Authentication Milter) with ESMTP
id 77BB96D4643;
Wed, 16 Jan 2019 13:36:41 -0500
ARC-Seal: i=1; a=rsa-sha256; cv=none; d=messagingengine.com; s=fm1; t=
1547663801; b=XQVlYwkJ1tOfDt35QQgTOubPp5wu1mBN0ePYtYViTk1emSDso6
JHrCFczX7Cy2RtQdJFr/yOmXEeLZrbnVQVUKdu0PJTXlw40YU7DBaBzf3v3pRrX1
cEuXVwi44Y4XfoSWQ0puDH5/DqKK//ayRarPiruxo23YFum458lpfbOSh80pndqb
I13ttCxArGHcfKRXasTNSaNNfqdEZ5KSIvMsOxkm9D9+vmRrvkXu6UDCZ8pNIeaA
5BeGPcMt2VDpxQcgamJMoSWw+JrNSFXEv11/d15PpJsvmCkQKcq15Kz1zpX4D6UY
m+SFgH2hvmrAlSx95xS+s7uRYBO2V7fAScqQ==
ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=
messagingengine.com; h=from:to:subject:date:message-id
:references:in-reply-to:content-type:mime-version; s=fm1; t=
1547663801; bh=ydM1g0xswHTQu/UDjY9rKf9RGvjnnmB2GNRUpAj8t5c=; b=V
VHNfpLfrYFcLyhiKBbHDQv3pSDweybBqFlrV+BR0gBknexmyDqWAukKRFYu3ue5c
o+dOlYL6zJ8BNC+DPW+zqAFz3sial5JLV4NLlj5y3hkLrFWkFLoOuuCkWAM4BYs3
VT3+2ZhzcgN/aH70cj5eT3dPBCEWJRdaelUvqiEhfnFUs8I/gXLMbrWPlovs6Cct
PBZ6xM/ylAAz1ncF6y3+lhVXukrypLhS/ThF0la0m+lC9p7S2zjzUaVY4bvkWinx
n6Ag/WixrKXS8dm1WRUofi53rQtramLiXuHe2aq+KiRt9xDj1L3WraFlnwilrYjG
9i6KtSJoK7XnTPPmq6XHA==
ARC-Authentication-Results: i=1; mx1.messagingengine.com; arc=none (no signatures found);
dkim=pass (1024-bit rsa key sha256) header.d=stantec.onmicrosoft.com
[email protected] header.b=sJphFcgj
header.a=rsa-sha256 header.s=selector1-stantec-com x-bits=1024;
dmarc=none policy.published-domain-policy=none
policy.applied-disposition=none policy.evaluated-disposition=none
(p=none,d=none,d.eval=none) policy.policy-from=p
header.from=stantec.com;
iprev=pass smtp.remote-ip=40.107.77.124
(mail-eopbgr770124.outbound.protection.outlook.com);
spf=pass [email protected]
smtp.helo=NAM02-SN1-obe.outbound.protection.outlook.com;
x-aligned-from=pass (Address match);
x-ptr=fail smtp.helo=NAM02-SN1-obe.outbound.protection.outlook.com
policy.ptr=mail-eopbgr770124.outbound.protection.outlook.com;
x-return-mx=pass header.domain=stantec.com policy.is_org=yes
(MX Record found);
x-return-mx=pass smtp.domain=stantec.com policy.is_org=yes
(MX Record found);
x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES128-SHA
smtp.bits=128/128;
x-vs=clean score=0 state=0;
x-zs=clean
Authentication-Results: mx1.messagingengine.com;
arc=none (no signatures found);
dkim=pass (1024-bit rsa key sha256) header.d=stantec.onmicrosoft.com
[email protected] header.b=sJphFcgj
header.a=rsa-sha256 header.s=selector1-stantec-com x-bits=1024;
dmarc=none policy.published-domain-policy=none
policy.applied-disposition=none policy.evaluated-disposition=none
(p=none,d=none,d.eval=none) policy.policy-from=p
header.from=stantec.com;
iprev=pass smtp.remote-ip=40.107.77.124
(mail-eopbgr770124.outbound.protection.outlook.com);
spf=pass [email protected]
smtp.helo=NAM02-SN1-obe.outbound.protection.outlook.com;
x-aligned-from=pass (Address match);
x-ptr=fail smtp.helo=NAM02-SN1-obe.outbound.protection.outlook.com
policy.ptr=mail-eopbgr770124.outbound.protection.outlook.com;
x-return-mx=pass header.domain=stantec.com policy.is_org=yes
(MX Record found);
x-return-mx=pass smtp.domain=stantec.com policy.is_org=yes
(MX Record found);
x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES128-SHA
smtp.bits=128/128;
x-vs=clean score=0 state=0;
x-zs=clean
X-ME-VSSU: VW5zdWI9aHR0cDovL2hlYy1yYXMtaGVscC4xMDkxMTEyLm41Lm5hYmJsZS5jb20vdGVtcG
xhdGUvTmFtbFNlcnZsZXQuanRwP21hY3JvPXVuc3Vic2NyaWJlX2J5X2NvZGUmbm9kZT02
NjczJmNvZGU9YkdsellTNXNZWFYyWlhKQWMzUmhiblJsWXk1amIyMThOalkzTTN3eE1USX
hOVFF5TkRZeg
X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgedtledrgeehgdduudehucetufdoteggodetrfdotf
fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu
rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucenucfjughrpefhvffuth
ffkfhfjghitgggsegrtddtredttddvnecuhfhrohhmpedfnfgruhhvvghrpdcunfhishgr
fdcuoehlihhsrgdrlhgruhhvvghrsehsthgrnhhtvggtrdgtohhmqeenucffohhmrghinh
epnhgrsggslhgvrdgtohhmnecukfhppeegtddruddtjedrjeejrdduvdegpdegrdefgedr
hedvrddufeegpdhfvgektdemmegsleefheemfhelfegumegsgedvjeemheekudegnecurf
grrhgrmhepihhnvghtpeegtddruddtjedrjeejrdduvdegpdhhvghloheppfetofdtvddq
uffpuddqohgsvgdrohhuthgsohhunhgurdhprhhothgvtghtihhonhdrohhuthhlohhokh
drtghomhdpmhgrihhlfhhrohhmpeeolhhishgrrdhlrghuvhgvrhesshhtrghnthgvtgdr
tghomhequcfukfgkgfepvddtuddukeenucevlhhushhtvghrufhiiigvpedt
X-ME-VSCategory: clean
X-ME-ZSResult: clean
Received-SPF: pass
(stantec.com: Sender is authorized to use ‘[email protected]’ in ‘mfrom’ identity (mechanism ‘include:spf.protection.outlook.com’ matched))
receiver=mx1.messagingengine.com;
identity=mailfrom;
envelope-from=”[email protected]”;
helo=NAM02-SN1-obe.outbound.protection.outlook.com;
client-ip=40.107.77.124
Received: from NAM02-SN1-obe.outbound.protection.outlook.com (mail-eopbgr770124.outbound.protection.outlook.com [40.107.77.124])
(using TLSv1.2 with cipher ECDHE-RSA-AES128-SHA (128/128 bits))
(No client certificate requested)
by mx1.messagingengine.com (Postfix) with ESMTPS
for; Wed, 16 Jan 2019 13:36:38 -0500 (EST)
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
d=stantec.onmicrosoft.com; s=selector1-stantec-com;
h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck;
bh=ydM1g0xswHTQu/UDjY9rKf9RGvjnnmB2GNRUpAj8t5c=;
b=sJphFcgjjxv4fvumJZm1Yiu+W58HeMCK7znPUhaT1E/XTs2iPJrV616swN8E9HCVbZA2LLB76oTMcT+77tw/8O68S56qOWBBLCmrUj+lrRiLKYjo8kuEhvaHoXkCNSlTds319K/pyvvdaBv2qbxk7+Z9z+zxCMlKCeO4IuObWY0=
Received: from DM6PR06MB4460.namprd06.prod.outlook.com (20.176.113.150) by
DM6PR06MB4857.namprd06.prod.outlook.com (20.176.120.21) with Microsoft SMTP
Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id
15.20.1516.18; Wed, 16 Jan 2019 18:36:35 +0000
Received: from DM6PR06MB4460.namprd06.prod.outlook.com
([fe80::b935:f93d:b427:5814]) by DM6PR06MB4460.namprd06.prod.outlook.com
([fe80::b935:f93d:b427:5814%6]) with mapi id 15.20.1537.018; Wed, 16 Jan 2019
18:36:35 +0000
From: “Lauver, Lisa”To: “MinutemanModeler [via HEC-RAS Help]”
Subject: RE: Warning: Count for bucket 0 exceeds maximum 32 bit value
Thread-Topic: Warning: Count for bucket 0 exceeds maximum 32 bit value
Thread-Index: AQHUraBazMs2QH10uU6BOxARcafrOqWyOOfA
Date: Wed, 16 Jan 2019 18:36:35 +0000
Message-ID:
References: <[email protected]>
<[email protected]>
In-Reply-To: <[email protected]>
Accept-Language: en-US
Content-Language: en-US
X-MS-Has-Attach:
X-MS-TNEF-Correlator:
authentication-results: spf=none (sender IP is )
[email protected];
x-originating-ip: [4.34.52.134]
x-ms-publictraffictype: Email
x-microsoft-exchange-diagnostics:
1;DM6PR06MB4857;6:qWqKUUEEDmOxY0LDoZCoyt/KL5Aqx04tnI62bnorAm/pxuUbd4Qab/zu2mqLOaqVf0O2w3Un5V2OQa1kC+xJm/bgWMvIi3XJGN+TaqphBjCG8/YVQQ2t8SLKkgGOaOHzdITwyA2QVD5ftyud8WYxFIst+iREkDD/EZaPcgEF1GFkdGf45TkK3JVIz2497XfxijuNvzOuOZmaVqGBRQxoCpcnYqr1wSZ3rgqaV3k9Kkemd/1aX641kSbVw4Vdh7gD7Y5ylzjuIqKqwGQdMOGSUIGC/+hSOmOdhk5xTeJJrNRDBeIaRknfA8YV7OC4PxVE4duC3YulZD9++IcudUD52vrHREEqrZ/d8ffrDisYRdMTYGSFkpoO0IolsMEk/DabJ/bi0R6MdZCfjpNoU7OwgrVJU47e1Rer4k5MWwYW/q6NCnfQfCjivDBuLVxujkoPW1W1pSMqpwBl+mdSFc2DVw==;5:wjEpal4Kyg2tPuVE54GJbReikeX6PuUNfjWrSRyWPJg6CFekxKwLYpQY+3teNZp0Qmk9rD81hQksTnP0G0yd5Xp5pKTApzUqLKf68in1hTvwN224WCAfWakUH/R5jfCcmC0gAFF8mM54Peqvy/9pMzWyprOmFvvfMB+3Pa+YPe3Pu5V6a0dtCNkAJhnd6S9EWkqvCGEQcIqYxq9mA0sI+A==;7:pa6mPusvarfQMME39f8OGadS4iBFBqQilJ9uSRBoF4xscJ7CoXxLiT0GoRfz8jDfbAlOIIYcHjE435y+9xsOJU9Sq8krQ3ChMv6R2TYqKcQcQPwUFQ8PM+LFW9NSammSSRFupHBOGRs0r8tuzGXzPw==
x-ms-exchange-antispam-srfa-diagnostics: SOS;
x-ms-office365-filtering-correlation-id: 78761b0a-87bb-4e9c-fd26-08d67be18b85
x-microsoft-antispam:
BCL:0;PCL:0;RULEID:(2390118)(7020095)(4652040)(8989299)(5600109)(711020)(4534185)(4627221)(201703031133081)(201702281549075)(8990200)(2017052603328)(7153060)(7193020);SRVR:DM6PR06MB4857;
x-ms-traffictypediagnostic: DM6PR06MB4857:
x-microsoft-antispam-prvs:
x-forefront-prvs: 091949432C
x-forefront-antispam-report:
SFV:NSPM;SFS:(10019020)(366004)(376002)(39860400002)(396003)(136003)(346002)(199004)(189003)(74316002)(8936002)(6116002)(790700001)(3846002)(2906002)(229853002)(66066001)(71190400001)(71200400001)(33656002)(606006)(8676002)(81166006)(81156014)(5660300001)(7066003)(99286004)(14444005)(68736007)(6436002)(86362001)(55016002)(256004)(4744005)(486006)(966005)(21615005)(7696005)(476003)(446003)(6506007)(478600001)(14454004)(25786009)(6246003)(7736002)(54896002)(9686003)(236005)(11346002)(97736004)(186003)(106356001)(316002)(6306002)(102836004)(53546011)(26005)(105586002)(76176011)(136015008)(53936002)(10126004);DIR:OUT;SFP:1102;SCL:1;SRVR:DM6PR06MB4857;H:DM6PR06MB4460.namprd06.prod.outlook.com;FPR:;SPF:None;LANG:en;PTR:InfoNoRecords;A:1;MX:1;
received-spf: None (protection.outlook.com: stantec.com does not designate
permitted sender hosts)
x-ms-exchange-senderadcheck: 1
x-microsoft-antispam-message-info:
B++yEKPIUc9C4BsULPHVrH5I2g0t6MTOWGCJs950dYbtSAJ8/vfggghPZSofpaWq8YKICN8BfbzDBv0gbCMBVJLdYKzOAQBBgn8ukIK87NTwed3OYNmlB8+Kl47aYZbEaWaeTQOXkCTcITYH14IPB/H7x6v21tvP1ScqsB7hjZddhwlHhMqmh0xodx2S89xn1521edKnKekhIjO03GRRXm+K8fE+h0pZ7kQcBrd3A6LiUH4PM4Xb1UUO0zBWvOEPtQMiz/mJv3DXU/MDNs70AkOsdAtjzkFcbCsGhOLgrvriWTYIef5TaMwoo/vW6pCG61+dWwSLVbUH4o5kHc8dJm9bjW9ANoDMPjNNhwWwxM9h2BRBa4Sn0BudO+S5BXrQ+3fXZ4eFU9vlWN9YtA0Kjwmque4v3lYk6nPoy4NsP2s=
spamdiagnosticoutput: 1:99
spamdiagnosticmetadata: NSPM
Content-Type: multipart/alternative;
boundary=”_000_DM6PR06MB4460BE690DCB4C8F569D801DEF820DM6PR06MB4460namp_”
MIME-Version: 1.0
X-OriginatorOrg: stantec.com
X-MS-Exchange-CrossTenant-Network-Message-Id: 78761b0a-87bb-4e9c-fd26-08d67be18b85
X-MS-Exchange-CrossTenant-originalarrivaltime: 16 Jan 2019 18:36:35.7394
(UTC)
X-MS-Exchange-CrossTenant-fromentityheader: Hosted
X-MS-Exchange-CrossTenant-id: 413c6f2c-219a-4692-97d3-f2b4d80281e7
X-MS-Exchange-Transport-CrossTenantHeadersStamped: DM6PR06MB4857–_000_DM6PR06MB4460BE690DCB4C8F569D801DEF820DM6PR06MB4460namp_
Content-Type: text/plain; charset=”us-ascii”
Content-Transfer-Encoding: quoted-printableNo, I was unable to resolve this error or even find out exactly what it mea=
nt. But the model seemed to run fine despite the error. And the reviewers=
were not concerned about it either.Lisa
From: MinutemanModeler [via HEC-RAS Help]
Sent: Wednesday, January 16, 2019 6:35 AM
To: Lauver, LisaSubject: Re: Warning: Count for bucket 0 exceeds maximum 32 bit value Any luck resolving this issue?
I am having a similar error except my program is indicating “bucket 255”.
Thanks
________________________________
If you reply to this email, your message will be added to the discussion be=
low:
http://hec-ras-help.1091112.n5.nabble.com/Warning-Count-for-bucket-0-exceed=
s-maximum-32-bit-value-tp6673p7044.html
To unsubscribe from Warning: Count for bucket 0 exceeds maximum 32 bit valu=
e, click here<http://hec-ras-help.1091112.n5.nabble.com/template/NamlServle=
t.jtp?macro=3Dunsubscribe_by_code&node=3D6673&code=3DbGlzYS5sYXV2ZXJAc3Rhbn=
RlYy5jb218NjY3M3wxMTIxNTQyNDYz>.
NAML<http://hec-ras-help.1091112.n5.nabble.com/template/NamlServlet.jtp?mac=
ro=3Dmacro_viewer&id=3Dinstant_html%21nabble%3Aemail.naml&base=3Dnabble.nam=
l.namespaces.BasicNamespace-nabble.view.web.template.NabbleNamespace-nabble=
.naml.namespaces.BasicNamespace-nabble.view.web.template.NabbleNamespace-na=
bble.naml.namespaces.BasicNamespace-nabble.view.web.template.NabbleNamespac=
e-nabble.naml.namespaces.BasicNamespace-nabble.view.web.template.NabbleName=
space-nabble.naml.namespaces.BasicNamespace-nabble.view.web.template.Nabble=
Namespace-nabble.view.web.template.NodeNamespace&breadcrumbs=3Dnotify_subsc=
ribers%21nabble%3Aemail.naml-instant_emails%21nabble%3Aemail.naml-send_inst=
ant_email%21nabble%3Aemail.naml>–_000_DM6PR06MB4460BE690DCB4C8F569D801DEF820DM6PR06MB4460namp_
Content-Type: text/html; charset=”us-ascii”
Content-Transfer-Encoding: quoted-printable
No, I was unable to resolve this error or =
even find out exactly what it meant. But the model seemed to run fine=
despite the error. And the reviewers were not concerned
about it either.Lisa
From: MinutemanModeler [via HEC-RAS Help] <=
;ml+[email protected]>
Sent: Wednesday, January 16, 2019 6:35 AM
To: Lauver, Lisa <[email protected]>
Subject: Re: Warning: Count for bucket 0 exceeds maximum 32 bit valu=
eAny luck resolving th=
is issue?
I am having a similar error except my program is indicating "bucket 25=
5".
Thanks
If you reply to this email, your mes=
sage will be added to the discussion below:To unsubsc=
ribe from Warning: Count for bucket 0 exceeds maximum 32 bit value,
click here.
NAML
–_000_DM6PR06MB4460BE690DCB4C8F569D801DEF820DM6PR06MB4460namp_–
-
AuthorPosts
- You must be logged in to reply to this topic.
